BUGGERALL

recent stuff from 3000

[website] Credit Cards Comparison | Compare Credit Cards
in compare card credit cards comparison at 2010-07-23 01:22:08
from melbourne vic 3000
++flag this listing as inappropriate++

---

[other] Car Insurance
in car insurance at 2010-06-23 11:31:12
from australia brisbane sydney melbourne cairns perth 4000 3000 5000 2000 darwin
++flag this listing as inappropriate++

---

[website] Car Rental
in car rental at 2010-06-23 11:28:21
from brisbane qld 4000 sydney nsw 2000 5000 3000
++flag this listing as inappropriate++

---

[website] IT Support Melbourne
in it support melbourne,network support & computer services at 2010-03-01 21:38:34
from vic , melbourne 3000
++flag this listing as inappropriate++

---

[blog] GSEO Is Doing Business in Melbourne
in seo melbourne, internet marketing, search engine optimisation, seo services at 2010-02-25 11:07:20
from 211 la trobe street, shop 101b, melbourne, 3000, vic
++flag this listing as inappropriate++

---

[other] AWD CMS and Ecommerce Web Designing for Business
in website web design internet marketing multimedia ecommerce crm cms telephony voip at 2010-01-29 09:36:52
from melbourne victoria 3000
++flag this listing as inappropriate++

---

[services] Services Directory
in business directories, online directory, business listings at 2009-12-29 12:47:39
from pascoe vale, melbourne, vic 3000
++flag this listing as inappropriate++

---

[services] Limo Melbourne
in limousine at 2009-12-08 20:51:02
from melbourne 3000 vic
++flag this listing as inappropriate++

---

[other] 2009 Melbourne Cup Betting Odds
in melbournecup melbourne cup betting odds spring racing at 2009-09-08 15:33:00
from melbourne 3000 victoria australia
++flag this listing as inappropriate++

---

[services] Mechanics
in mechanic, car repair, car service at 2009-05-13 11:37:00
from 2000, 1000, 3000, 4000, 5000, 6000
++flag this listing as inappropriate++

---

[blog] oddsundays
in design art food diy fashion photography graphics craft odd sundays australian melbourne jewellery recipes inspiration retro travel decoration events at 2009-04-29 15:14:24
from melbourne victoria australia perth 3000 3127
++flag this listing as inappropriate++

---

[blog] Melbournism
in melbourne, facts, bars, pubs at 2009-04-09 07:36:36
from melbourne vic 3000
++flag this listing as inappropriate++

---

[blog] Australian Indian Hindu Weddings
in australian indian hindu weddings shaadi at 2009-03-08 17:49:42
from melbourne 3000
++flag this listing as inappropriate++

---

[blog] natural skin care products and Health Supplements
in natural skin care products aromatherapy essential oils muscle supplements diet sports health protein creatine at 2009-01-27 11:08:12
from melbourne, victoria , 3000
++flag this listing as inappropriate++

---

[website] LEASE OUT YOUR CAR FOR CASH!!!
in cars lease rent cashincome drivers carowners holidays travel at 2008-12-06 15:10:28
from sydney nsw 2000 melbourne vic 3000 brisbane qld 4000 perth wa 8000
++flag this listing as inappropriate++

---

Go to Back 1 2 3 4 5 Next

recent location tags

2010 actor,yuvaimages.medipallyshivakrishna,shivakrishna,medipallysrikanth.trisha,illena,maheshbabu,teluguactre actress actress,hindi adelaide, australia australia, boots brisbane, businesses chanel cheap china designer discount films,bollywood gallery,download handbags hindi international internet latest melbourne, nsw online perth perth, photos,bollywood songs,bollywood sydney, ugg wa western