BUGGERALL

recent stuff from adelaide

[other] Australian business reviews
in australia, online, business, reviews, free, services, at 2010-08-26 11:23:56
from melbourne, brisbane, sydney, perth, adelaide, australia,
++flag this listing as inappropriate++

---

[blog] How do you enjoy going Cycling with your 5 year old?
in at 2008-10-19 15:23:45
from sydney brisbane adelaide melbourne launceston perth darwin nsw sa vic tas qld nt act
++flag this listing as inappropriate++

---

[blog] Cycle Tow Trail Gator Tag Along Trailer Bike
in tag along trailer bike bicycle tagalong tow cycle at 2008-10-19 15:14:54
from sydney brisbane adelaide melbourne launceston perth darwin
++flag this listing as inappropriate++

---

[blog] Online Marketing, Online Advertising & Interactive Industry Blog
in advertising online advertising interactive digital digital advertising online strategy website design online marketing marketing interactive interactive industry geo mapping google mashups at 2008-06-26 02:59:56
from australia nsw qld vic nt tas wa sa sydney brisbane melbourne adelaide hobart darwin perth
++flag this listing as inappropriate++

---

[website] mcNetwork - Australian online motorcycle directory
in motorbike motorcycle directory services parts dealers parking at 2008-06-20 01:11:08
from sydney melbourne brisbane adelaide hobart perth
++flag this listing as inappropriate++

---

[website] AU Domain Trade Forum
in domain forum webdesign develop sites domains at 2008-06-17 06:02:51
from melbourne sydney brisbane adelaide perth hobart darwin canberra
++flag this listing as inappropriate++

---

[website] RuralStar.com.au
in rural events rural classifieds bush classifieds rural news rural articles rural real estate outback events events shows bns balls ute musters at 2008-06-17 04:00:14
from western australia victoria south australia new south wales queensland tasmania australian capital territory northern territory nsw wa nt act sa vic tas qld perth adelaide melbourne
++flag this listing as inappropriate++

---

[website] impulsifly
in flight travel compare impulsifly at 2008-06-10 22:57:19
from sydney darwin melbourne brisbane perth canberra adelaide hobart
++flag this listing as inappropriate++

---

[other] mosaic communication\\\'s blog
in marketing communication branding public relations business at 2008-05-17 23:24:31
from adelaide sa 5000
++flag this listing as inappropriate++

---

[blog] OzTraveller
in travel holidays vacation deals airlines insurance airfares jetstar airasia tiger tech qantas virginblue virgin money languages asia europe london uk england thailand singapore italy germany spain ma at 2008-05-14 17:56:25
from national victoria nsw sydney melbourne brisbane gold coast queensland perth wa darwin adelaide south australia
++flag this listing as inappropriate++

---

[blog] The Piping Shrike
in politics australia at 2008-04-13 06:11:20
from adelaide canberra
++flag this listing as inappropriate++

---

[blog] Fashionistablog - kids fashion blog for savvy & stylish parents
in baby clothes baby clothing baby gifts baby fashion baby nursery funny parenting at 2008-03-20 20:18:56
from adelaide
++flag this listing as inappropriate++

---

[blog] Learning How
in learning how articles website blog australian website teachings teaching study studies education at 2008-01-05 08:37:32
from sydney nsw new south wales 2000 2001 2002 2003 melbourne perth hobart adelaide western australia
++flag this listing as inappropriate++

---

[blog] Aussie Bloggers
in aussiebloggers aussie bloggers australian blog at 2008-01-02 19:55:48
from sydney melbourne brisbane adelaide hobart perth darwin canberra nsw qld vic sa nt act wa tas
++flag this listing as inappropriate++

---

[forsale] Tiny Chihuahua Puppies
in puppy chihuahua teacup at 2007-12-14 11:55:39
from sydney perth brisbane adelaide
++flag this listing as inappropriate++

---

Go to Back 1 2 3 4 5 6 7 Next

recent location tags

2010 actor,yuvaimages.medipallyshivakrishna,shivakrishna,medipallysrikanth.trisha,illena,maheshbabu,teluguactre actress actress,hindi adelaide, australia australia, boots brisbane, businesses chanel cheap china designer discount films,bollywood gallery,download handbags hindi international internet latest melbourne, nsw online perth perth, photos,bollywood songs,bollywood sydney, ugg wa western