BUGGERALL

recent stuff from canberra

[website] Canberra.com.au
in canberra australia accommodation flights airport tourism canberranews canberraweather act at 2009-10-15 08:06:08
from canberra nsw act australia
++flag this listing as inappropriate++

---

[event] ANZAC Day 2009
in anzac, anzac day, anzac day 2009 at 2009-04-22 09:44:20
from canberra
++flag this listing as inappropriate++

---

[blog] Akwoo Photography Blog
in wedding photography landscape portrait at 2009-04-01 09:22:05
from melbourne canberra
++flag this listing as inappropriate++

---

[website] Canberra Restaurants
in canberra, canberra travel, canberra restaurants, food at 2009-01-07 13:24:03
from canberra act
++flag this listing as inappropriate++

---

[blog] Flashman\\\'s Retreat
in harryflashman flashman quotes flashmanquotes georgemacdonaldfraser popularliterature at 2008-08-16 13:14:43
from canberra act 2601
++flag this listing as inappropriate++

---

[website] AU Domain Trade Forum
in domain forum webdesign develop sites domains at 2008-06-17 06:02:51
from melbourne sydney brisbane adelaide perth hobart darwin canberra
++flag this listing as inappropriate++

---

[website] impulsifly
in flight travel compare impulsifly at 2008-06-10 22:57:19
from sydney darwin melbourne brisbane perth canberra adelaide hobart
++flag this listing as inappropriate++

---

[blog] The Piping Shrike
in politics australia at 2008-04-13 06:11:20
from adelaide canberra
++flag this listing as inappropriate++

---

[blog] light sweet crude
in parenting cooking photography kids at 2008-01-22 20:30:03
from canberra
++flag this listing as inappropriate++

---

[blog] My Big World of Crap
in canberra australia politics news sport music oddities at 2008-01-12 23:01:59
from canberra act 2614
++flag this listing as inappropriate++

---

[blog] Aussie Bloggers
in aussiebloggers aussie bloggers australian blog at 2008-01-02 19:55:48
from sydney melbourne brisbane adelaide hobart perth darwin canberra nsw qld vic sa nt act wa tas
++flag this listing as inappropriate++

---

[blog] Quick Gifts
in gift kid children shop quick birthday christmas easy simple fast australian business gift card present idea at 2007-11-26 20:00:16
from canberra australia adelaide melbourne victoria
++flag this listing as inappropriate++

---

[blog] littlelioness.net
in at 2007-11-20 06:18:22
from canberra act 2605
++flag this listing as inappropriate++

---

[blog] Federal Election: Share your thoughts
in election vote national federal liberal labour john howard kevin rudd politics at 2007-11-13 00:31:35
from qld vic tas act sa wa nsw sydney canberra melbourne brisbane adelaide perth hobart
++flag this listing as inappropriate++

---

[blog] Harty Photos
in photos photography blog photoblog art artist at 2007-10-27 05:54:34
from canberra act
++flag this listing as inappropriate++

---

Go to Back 1 2 3 4 5 Next

recent location tags

2010 actor,yuvaimages.medipallyshivakrishna,shivakrishna,medipallysrikanth.trisha,illena,maheshbabu,teluguactre actress actress,hindi adelaide, australia australia, boots brisbane, businesses chanel cheap china designer discount films,bollywood gallery,download handbags hindi international internet latest melbourne, nsw online perth perth, photos,bollywood songs,bollywood sydney, ugg wa western