BUGGERALL

recent location tags

2010 actor,yuvaimages.medipallyshivakrishna,shivakrishna,medipallysrikanth.trisha,illena,maheshbabu,teluguactre actress actress,hindi adelaide, australia australia, boots brisbane, businesses chanel cheap china designer discount films,bollywood gallery,download handbags hindi international internet latest melbourne, nsw online perth perth, photos,bollywood songs,bollywood sydney, ugg wa western

recent stuff tagged skin

[website] Skin Care
in skin care at 2010-07-14 21:22:31
from
++flag this listing as inappropriate++

---

[event] Beauty Treatments
in beauty treatments, makeup course, lash treatments, brow treatments, facial treatment, bleaching treatments, massage treatment, manual facial treatments, manual skin treatments, beauty therapy treatmen at 2009-05-14 16:18:37
from beauty treatments, makeup course, lash treatments, brow treatments, facial treatment, bleaching treatments, massage treatment, manual facial treatments, manual skin treatments, beauty therapy treatmen
++flag this listing as inappropriate++

---

[blog] natural skin care products and Health Supplements
in natural skin care products aromatherapy essential oils muscle supplements diet sports health protein creatine at 2009-01-27 11:08:12
from melbourne, victoria , 3000
++flag this listing as inappropriate++

---

[want2buy] Aromatherapy 5-Point System
in aromatherapy melbourne,aromatherapy accessories,aromatherapy products,aromatherapy essential oils,natural skin care products at 2009-01-13 11:43:53
from 315 neerim road, carnegie, 3163 victoria aromacare victoria
++flag this listing as inappropriate++

---

[services] Bella Day Spas in Melbourne
in day spas in melbourne, day spa gift, bella medispa, medispa melbourne, bella, pevonia skin care products, pevonia day spa at 2008-08-08 09:51:57
from kealba, victoria, 3021
++flag this listing as inappropriate++

---

[employment] Own your own business! Ground floor opportunity!
in business opportunity anti-aging skin care work at home at 2007-07-16 00:02:02
from sydnye melbourne queensland
++flag this listing as inappropriate++

---

[blog] Anti Wrinkle treatments
in wrinkle treatment cream antiaging skin care beautiful beauty health at 2007-05-08 08:31:16
from sydney nsw new south wales australia perth melbourne victoria tasmania
++flag this listing as inappropriate++

---

[website] Jessica Tremp Photography
in redbubble jessica tremp photography prints buy painting drawing art africa travel emotions love anguish world cultures himba tribal landscape body human impact skin door africa india kenya ethiopia ta at 2007-06-14 00:38:33
from victoria australia fitzroy melbourne 3000 3065 northernsuburbs collingwood
++flag this listing as inappropriate++

---

Go to 1