BUGGERALL

recent location tags

2010 actor,yuvaimages.medipallyshivakrishna,shivakrishna,medipallysrikanth.trisha,illena,maheshbabu,teluguactre actress actress,hindi adelaide, australia australia, boots brisbane, businesses chanel cheap china designer discount films,bollywood gallery,download handbags hindi international internet latest melbourne, nsw online perth perth, photos,bollywood songs,bollywood sydney, ugg wa western

recent stuff tagged website

[other] AWD CMS and Ecommerce Web Designing for Business
in website web design internet marketing multimedia ecommerce crm cms telephony voip at 2010-01-29 09:36:52
from melbourne victoria 3000
++flag this listing as inappropriate++

---

[website] Splashbox, SEO, Web Design, Online Marketing, Search Engine Optimisation
in seo website design melbourne online marketing search engine optimisation australia email marketing web design st kilda online shopping carts ecommerce melbourne at 2009-11-19 08:25:29
from st kilda victoria
++flag this listing as inappropriate++

---

[website] Web Link Directory - Free Link Directory, Reciprocal Link Exchange
in website directory submit url directory business directory submitawebsite sitesaddurl premium links directory at 2009-10-17 23:08:45
from
++flag this listing as inappropriate++

---

[other] Alexa
in website information, data analysis at 2009-06-06 16:32:43
from uk
++flag this listing as inappropriate++

---

[website] Custom Website Design And Development Offshore Outsourcing India - Infodreamz Technologies
in professional web design company, website design, web design company, website designing company india, web 2.0, website design at 2009-05-28 17:16:55
from
++flag this listing as inappropriate++

---

[blog] Insite Website Design Blog + Podcast
in website design, website design tips, web design advice, web development, website development advice, graphic design tips, photoshop, wordpress, photoshop tips, wordpress tips, wordpress programming, s at 2009-04-27 09:45:04
from
++flag this listing as inappropriate++

---

[services] Affordable SEO Services : Expert SEO Consultations
in seo, search engine optimization, seo services, website seo, seo company, seo marketing, seo consultant, seo google, google seo, internet marketing seo, seo expert, seo specialist, affordable seo, seo at 2009-02-12 23:08:46
from australia
++flag this listing as inappropriate++

---

[blog] Online Marketing, Online Advertising & Interactive Industry Blog
in advertising online advertising interactive digital digital advertising online strategy website design online marketing marketing interactive interactive industry geo mapping google mashups at 2008-06-26 02:59:56
from australia nsw qld vic nt tas wa sa sydney brisbane melbourne adelaide hobart darwin perth
++flag this listing as inappropriate++

---

[blog] Small business websites & marketing online
in sme website online marketing small business success planing robert beerworth at 2008-05-08 00:43:34
from sydney australia
++flag this listing as inappropriate++

---

[website] Macronimous Web Design Blog
in website designing seo at 2008-04-02 08:50:32
from
++flag this listing as inappropriate++

---

[blog] Seofinance.com.au was created to fill a market vacancy for online business operators who were lookin
in seo finance seo search engine optimisation online marketing sem website business finance at 2008-02-14 01:58:17
from sydney nsw australia
++flag this listing as inappropriate++

---

[blog] Learning How
in learning how articles website blog australian website teachings teaching study studies education at 2008-01-05 08:37:32
from sydney nsw new south wales 2000 2001 2002 2003 melbourne perth hobart adelaide western australia
++flag this listing as inappropriate++

---

[other] Demonz Media - Multimedia Website Design
in design web demonz newsletter news development 2007 media search engine optimisation seo site archive multimedia sydney website solutions australia interactive user interface crea at 2007-08-06 00:29:15
from surry hills sydney nsw 2010
++flag this listing as inappropriate++

---

[website] Australian Web Directories List
in australian website directory australian web directory list australian web index at 2007-06-23 07:10:21
from
++flag this listing as inappropriate++

---

[website] Arrowsmith Websites
in maleny website design hosting domain names seo sunshinecoast at 2007-02-22 01:42:48
from maleny sunshinecoast qld 4552
++flag this listing as inappropriate++

---

Go to 1 2 Next